SCOPe 2.04: Domain d2bhya1: 2bhy A:14-110

Lineage for d2bhya1 (2bhy A:14-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
   domain architecture similar to isoamylase

7. Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)
   Uniprot Q9RX51 14-110

8. Domain d2bhya1: 2bhy A:14-110 [128559]
   Other proteins in same PDB: d2bhya2, d2bhya3
   automated match to d2bhua1
   complexed with bme, glc, mg, tre, trs

Details for d2bhya1

PDB Entry: 2bhy, 1.5 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with trehalose

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2bhya1:

Sequence; same for both SEQRES and ATOM records:

>d2bhya1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

Timeline for d2bhya1:

• d2bhya1 first appeared in SCOP 1.73
  
• d2bhya1 appears in SCOPe 2.03
  
• d2bhya1 appears in SCOPe 2.05
  
• d2bhya1 appears in the current release, SCOPe 2.08