Lineage for d2bhua3 (2bhu A:111-530)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682462Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
    contains an additional N-terminal domain
  7. 682466Species Deinococcus radiodurans [TaxId:1299] [141769] (9 PDB entries)
  8. 682467Domain d2bhua3: 2bhu A:111-530 [128556]
    Other proteins in same PDB: d2bhua1, d2bhua2
    complexed with mg, pge, trs; mutant

Details for d2bhua3

PDB Entry: 2bhu (more details), 1.1 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOP Domain Sequences for d2bhua3:

Sequence, based on SEQRES records: (download)

>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]}
tfdwtdadwhgikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafd
gqrgwgydgaafyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyap
syftdrfssawgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethilt
elaqeihelggthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyr
ggaealaytirrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplger
lhqsdgvtlheyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkk
efggfsgfsgedvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnr

Sequence, based on observed residues (ATOM records): (download)

>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]}
tfdwtdadwhgikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafd
gqrgwgydgaafyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyap
syftdrfssawgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethilt
elaqeihelggthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyr
ggaealaytirrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplger
lhqsdgvtlheyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkk
efdvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnr

SCOP Domain Coordinates for d2bhua3:

Click to download the PDB-style file with coordinates for d2bhua3.
(The format of our PDB-style files is described here.)

Timeline for d2bhua3: