SCOP 1.73: Domain d2bhua2: 2bhu A:531-602

Lineage for d2bhua2 (2bhu A:531-602)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)

7. Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries)

8. Domain d2bhua2: 2bhu A:531-602 [128555]
   Other proteins in same PDB: d2bhua1, d2bhua3
   complexed with mg, pge, trs; mutant

Details for d2bhua2

PDB Entry: 2bhu, 1.1 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOP Domain Sequences for d2bhua2:

Sequence; same for both SEQRES and ATOM records:

>d2bhua2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]}
qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred
ltlgageavlvg

Timeline for d2bhua2:

• d2bhua2 is new in SCOP 1.73
  
• d2bhua2 appears in SCOP 1.75
  
• d2bhua2 appears in the current release, SCOPe 2.08