![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
![]() | Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
![]() | Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries) |
![]() | Domain d2bhtd1: 2bht D:2-293 [128553] automatically matched to 2BHT A:2-293 mutant |
PDB Entry: 2bht (more details), 2.1 Å
SCOP Domain Sequences for d2bhtd1:
Sequence, based on SEQRES records: (download)
>d2bhtd1 c.79.1.1 (D:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg ardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitg vsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvfg
>d2bhtd1 c.79.1.1 (D:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg dvlieatsgntgialamiaalkgyrmkllmpderraamraygaelimegardlalemanr gegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitgvsefmreqskp vtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentmrelavregifc gvssggavagalrvakanpdavvvaiicdrgdrylstgvfg
Timeline for d2bhtd1: