Lineage for d2bhtb1 (2bht B:2-293)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844422Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 844423Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 844424Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 844528Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 844532Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries)
    Uniprot P16703 2-293
  8. 844538Domain d2bhtb1: 2bht B:2-293 [128551]
    automatically matched to 2BHT A:2-293
    mutant

Details for d2bhtb1

PDB Entry: 2bht (more details), 2.1 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase b
PDB Compounds: (B:) Cysteine synthase B

SCOP Domain Sequences for d2bhtb1:

Sequence, based on SEQRES records: (download)

>d2bhtb1 c.79.1.1 (B:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitg
vsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvfg

Sequence, based on observed residues (ATOM records): (download)

>d2bhtb1 c.79.1.1 (B:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg
dvlieatsgntgialamiaalkgyrmkllmpdnrraamraygaeliegardemanrgegk
lldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitgvsefmreqskpvtiv
glqpeegssipgirrwpteylpgifnaslvdevldihqrdaentmrelavregifcgvss
ggavagalrvakanpdavvvaiicdrgdrylstgvfg

SCOP Domain Coordinates for d2bhtb1:

Click to download the PDB-style file with coordinates for d2bhtb1.
(The format of our PDB-style files is described here.)

Timeline for d2bhtb1: