Lineage for d2bhta1 (2bht A:2-293)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621089Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1621090Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1621091Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1621194Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 1621198Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries)
    Uniprot P16703 2-293
  8. 1621199Domain d2bhta1: 2bht A:2-293 [128550]
    Other proteins in same PDB: d2bhtb_, d2bhtc_, d2bhtd_

Details for d2bhta1

PDB Entry: 2bht (more details), 2.1 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase b
PDB Compounds: (A:) Cysteine synthase B

SCOPe Domain Sequences for d2bhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhta1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitg
vsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvfg

SCOPe Domain Coordinates for d2bhta1:

Click to download the PDB-style file with coordinates for d2bhta1.
(The format of our PDB-style files is described here.)

Timeline for d2bhta1: