![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
![]() | Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries) Uniprot P16703 2-293 |
![]() | Domain d2bhta1: 2bht A:2-293 [128550] Other proteins in same PDB: d2bhtb_, d2bhtc_, d2bhtd_ complexed with plp |
PDB Entry: 2bht (more details), 2.1 Å
SCOPe Domain Sequences for d2bhta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhta1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg ardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitg vsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvfg
Timeline for d2bhta1: