SCOPe 2.07: Domain d2bhsd_: 2bhs D:

Lineage for d2bhsd_ (2bhs D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (38 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186974] (2 PDB entries)

8. Domain d2bhsd_: 2bhs D: [128549]
   Other proteins in same PDB: d2bhsa1
   automated match to d1o58a_
   complexed with plp

Details for d2bhsd_

PDB Entry: 2bhs, 2.67 Å

PDB Description: crystal structure of cysteine synthase b

PDB Compounds: (D:) Cysteine synthase B

SCOPe Domain Sequences for d2bhsd_:

Sequence; same for both SEQRES and ATOM records:

>d2bhsd_ c.79.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtitg
vsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf

Timeline for d2bhsd_:

• d2bhsd_ first appeared in SCOP 1.73, called d2bhsd1
  
• d2bhsd_ appears in SCOPe 2.06
  
• d2bhsd_ appears in the current release, SCOPe 2.08