Lineage for d2bhra2 (2bhr A:178-482)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113071Protein Dengue virus helicase [142328] (1 species)
  7. 2113072Species Dengue virus type 2 [TaxId:11060] [142329] (2 PDB entries)
    Uniprot Q91H74 1653-1957! Uniprot Q91H74 1958-2093
  8. 2113078Domain d2bhra2: 2bhr A:178-482 [128543]
    Other proteins in same PDB: d2bhrb3
    complexed with so4

Details for d2bhra2

PDB Entry: 2bhr (more details), 2.8 Å

PDB Description: dengue virus rna helicase
PDB Compounds: (A:) RNA helicase

SCOPe Domain Sequences for d2bhra2:

Sequence, based on SEQRES records: (download)

>d2bhra2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}
ieddifrkkrltimdlhpgagktkrylpaivreaikrglrtlilaptrvvaaemeealrg
lpiryqtpairaehtgreivdlmchatftmrllspirvpnynliimdeahftdpasiaar
gyistrvemgeaagifmtatppgsrdpfpqsnapimdeereiperswnsghewvtdfkgk
tvwfvpsikagndiaaclrkngkkviqlsrktfdseyiktrtndwdfvvttdisemganf
kaervidprrcmkpviltdgeervilagpmpvthssaaqrrgrvgrnpknendqyiymge
plend

Sequence, based on observed residues (ATOM records): (download)

>d2bhra2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}
ieddifrkkrltimdlhpgagktkrylpaivreaikrglrtlilaptrvvaaemeealrg
lpiryqreivdlmchatftmrllspirvpnynliimdeahftdpasiaargyistrvemg
eaagifmtatppgsrdpfpqsnapimdeereiperswnsghewvtdfkgktvwfvpsika
gndiaaclrkngkkviqlsrktfdseyiktrtndwdfvvttdisemganfkaervidprr
cmkpviltdgeervilagpmpvthssaaqrrgrvgrnpknendqyiymgeplend

SCOPe Domain Coordinates for d2bhra2:

Click to download the PDB-style file with coordinates for d2bhra2.
(The format of our PDB-style files is described here.)

Timeline for d2bhra2: