Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (3 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein Dengue virus helicase [142328] (1 species) |
Species Dengue virus type 2 [TaxId:11060] [142329] (2 PDB entries) |
Domain d2bhra1: 2bhr A:483-618 [128542] complexed with so4 |
PDB Entry: 2bhr (more details), 2.8 Å
SCOP Domain Sequences for d2bhra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhra1 c.37.1.14 (A:483-618) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys dplalkefkefaagrk
Timeline for d2bhra1: