Lineage for d2bhra1 (2bhr A:483-618)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697390Family c.37.1.14: RNA helicase [52724] (3 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 697391Protein Dengue virus helicase [142328] (1 species)
  7. 697392Species Dengue virus type 2 [TaxId:11060] [142329] (2 PDB entries)
  8. 697397Domain d2bhra1: 2bhr A:483-618 [128542]
    complexed with so4

Details for d2bhra1

PDB Entry: 2bhr (more details), 2.8 Å

PDB Description: dengue virus rna helicase
PDB Compounds: (A:) RNA helicase

SCOP Domain Sequences for d2bhra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhra1 c.37.1.14 (A:483-618) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}
edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl
pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys
dplalkefkefaagrk

SCOP Domain Coordinates for d2bhra1:

Click to download the PDB-style file with coordinates for d2bhra1.
(The format of our PDB-style files is described here.)

Timeline for d2bhra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bhra2