SCOPe 2.08: Domain d2bhra1: 2bhr A:483-618

Lineage for d2bhra1 (2bhr A:483-618)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein Dengue virus helicase, C-terminal domain [418961] (1 species)

7. Species Dengue virus type 2 [TaxId:11060] [419423] (2 PDB entries)
   Uniprot Q91H74

8. Domain d2bhra1: 2bhr A:483-618 [128542]
   Other proteins in same PDB: d2bhra2, d2bhrb2, d2bhrb3
   complexed with so4

Details for d2bhra1

PDB Entry: 2bhr, 2.8 Å

PDB Description: dengue virus rna helicase

PDB Compounds: (A:) RNA helicase

SCOPe Domain Sequences for d2bhra1:

Sequence; same for both SEQRES and ATOM records:

>d2bhra1 c.37.1.14 (A:483-618) Dengue virus helicase, C-terminal domain {Dengue virus type 2 [TaxId: 11060]}
edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl
pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys
dplalkefkefaagrk

Timeline for d2bhra1:

• d2bhra1 first appeared in SCOP 1.73
  
• d2bhra1 appears in SCOPe 2.07