Lineage for d2bhnc2 (2bhn C:20-147)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856833Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 1856845Protein XPF endonuclease [142447] (1 species)
  7. 1856846Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries)
    Uniprot Q9YC15 16-148
  8. 1856851Domain d2bhnc2: 2bhn C:20-147 [128539]
    Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1
    automatically matched to 2BGW A:16-148

Details for d2bhnc2

PDB Entry: 2bhn (more details), 3.2 Å

PDB Description: xpf from aeropyrum pernix
PDB Compounds: (C:) xpf endonuclease

SCOPe Domain Sequences for d2bhnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhnc2 c.52.1.20 (C:20-147) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
rvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrlf
eqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtalv
ieslarls

SCOPe Domain Coordinates for d2bhnc2:

Click to download the PDB-style file with coordinates for d2bhnc2.
(The format of our PDB-style files is described here.)

Timeline for d2bhnc2: