SCOPe: Structural Classification of Proteins — extended. Release 2.05 (February 2015, new entries added 2015-04-08)
Search SCOPe (example):

Lineage for d2bhja1 (2bhj A:77-497)

  1. Root: SCOPe 2.05
  2. 1878092Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1930673Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1930674Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1930675Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 1930676Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1930882Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1930957Domain d2bhja1: 2bhj A:77-497 [128533]
    automatically matched to d1m8da_
    complexed with fc1, hbi, hem

Details for d2bhja1

PDB Entry: 2bhj (more details), 3.2 Å
PDB Description: murine ino synthase with coumarin inhibitor
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2bhja1:

Sequence, based on SEQRES records: (download)

>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)

>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOPe Domain Coordinates for d2bhja1:

Click to download the PDB-style file with coordinates for d2bhja1.
(The format of our PDB-style files is described here.)

Timeline for d2bhja1:


SCOPe Copyright © 1994-2015 The SCOP and SCOPe authors
scope@compbio.berkeley.edu