SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bhja1 (2bhj A:77-497)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210107Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2210108Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2210109Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 2210110Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2210316Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 2210391Domain d2bhja1: 2bhj A:77-497 [128533]
    automatically matched to d1m8da_
    complexed with fc1, hbi, hem

Details for d2bhja1

PDB Entry: 2bhj (more details), 3.2 Å

PDB Description: murine ino synthase with coumarin inhibitor
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2bhja1:

Sequence, based on SEQRES records: (download)

>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)

>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOPe Domain Coordinates for d2bhja1:

Click to download the PDB-style file with coordinates for d2bhja1.
(The format of our PDB-style files is described here.)

Timeline for d2bhja1: