SCOPe: Structural Classification of Proteins — extended. Release 2.03 (October 2013)
Search SCOPe (example):

Lineage for d2bhja1 (2bhj A:77-497)

  1. Root: SCOPe 2.03
  2. 1389709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433745Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1433746Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1433747Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 protein domains)
  6. 1433748Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1433916Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1433991Domain d2bhja1: 2bhj A:77-497 [128533]
    automatically matched to d1m8da_
    complexed with fc1, hbi, hem

Details for d2bhja1

PDB Entry: 2bhj (more details)
PDB Description: murine ino synthase with coumarin inhibitor
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2bhja1:

Sequence, based on SEQRES records: (download)

>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)
>d2bhja1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOPe Domain Coordinates for d2bhja1:

Click to download the PDB-style file with coordinates for d2bhja1.
(The format of our PDB-style files is described here.)

Timeline for d2bhja1:


SCOPe Copyright © 1994-2014 The SCOP and SCOPe authors
scope@compbio.berkeley.edu