Lineage for d2bhib_ (2bhi B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032217Protein Cardiotoxin III [57337] (1 species)
  7. 3032218Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57338] (6 PDB entries)
    Uniprot P60301 22-81
  8. 3032223Domain d2bhib_: 2bhi B: [128532]
    automated match to d1h0ja_
    complexed with c10, sft

Details for d2bhib_

PDB Entry: 2bhi (more details), 2.31 Å

PDB Description: crystal structure of taiwan cobra cardiotoxin a3 complexed with sulfogalactoceramide
PDB Compounds: (B:) cytotoxin 3

SCOPe Domain Sequences for d2bhib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhib_ g.7.1.1 (B:) Cardiotoxin III {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn

SCOPe Domain Coordinates for d2bhib_:

Click to download the PDB-style file with coordinates for d2bhib_.
(The format of our PDB-style files is described here.)

Timeline for d2bhib_: