SCOPe 2.04: Domain d2bhfa2: 2bhf A:183-356

Lineage for d2bhfa2 (2bhf A:183-356)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries)
   Uniprot P07788

8. Domain d2bhfa2: 2bhf A:183-356 [128528]
   automated match to d1gska2
   complexed with cu1, gol

Details for d2bhfa2

PDB Entry: 2bhf, 2.5 Å

PDB Description: 3d structure of the reduced form of cota

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2bhfa2:

Sequence; same for both SEQRES and ATOM records:

>d2bhfa2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

Timeline for d2bhfa2:

• d2bhfa2 first appeared in SCOP 1.73
  
• d2bhfa2 appears in SCOPe 2.03
  
• d2bhfa2 appears in SCOPe 2.05
  
• d2bhfa2 appears in the current release, SCOPe 2.08