![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Spore coat protein A, CotA [89219] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries) |
![]() | Domain d2bhfa2: 2bhf A:183-356 [128528] automatically matched to d1gska2 complexed with cu1, gol |
PDB Entry: 2bhf (more details), 2.5 Å
SCOP Domain Sequences for d2bhfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhfa2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d2bhfa2: