Lineage for d2bhfa1 (2bhf A:2-182)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044451Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2044452Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
    Uniprot P07788
  8. 2044480Domain d2bhfa1: 2bhf A:2-182 [128527]
    automated match to d1gska1
    complexed with cu1, gol

Details for d2bhfa1

PDB Entry: 2bhf (more details), 2.5 Å

PDB Description: 3d structure of the reduced form of cota
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2bhfa1:

Sequence, based on SEQRES records: (download)

>d2bhfa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records): (download)

>d2bhfa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtiheepevktvvhlhggvtpddsdgypeawfskdf
eqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d2bhfa1:

Click to download the PDB-style file with coordinates for d2bhfa1.
(The format of our PDB-style files is described here.)

Timeline for d2bhfa1: