Lineage for d2bhca2 (2bhc A:177-440)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191902Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2191903Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2191904Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 protein domains)
  6. 2191905Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 2191906Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)
  8. 2191941Domain d2bhca2: 2bhc A:177-440 [128523]
    Other proteins in same PDB: d2bhca1
    automated match to d1n51a2
    complexed with flc, mg, na

Details for d2bhca2

PDB Entry: 2bhc (more details), 2.4 Å

PDB Description: Na substituted E. coli Aminopeptidase P
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bhca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhca2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bhca2:

Click to download the PDB-style file with coordinates for d2bhca2.
(The format of our PDB-style files is described here.)

Timeline for d2bhca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bhca1