SCOPe 2.06: Domain d2bhba2: 2bhb A:177-440

Lineage for d2bhba2 (2bhb A:177-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (20 PDB entries)

8. Domain d2bhba2: 2bhb A:177-440 [128521]
   Other proteins in same PDB: d2bhba1
   automated match to d1n51a2
   complexed with flc, mg, mrd, zn

Details for d2bhba2

PDB Entry: 2bhb, 2.41 Å

PDB Description: zn substituted e. coli aminopeptidase p

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2bhba2:

Sequence; same for both SEQRES and ATOM records:

>d2bhba2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d2bhba2:

• d2bhba2 first appeared in SCOP 1.73
  
• d2bhba2 appears in SCOPe 2.05
  
• d2bhba2 appears in SCOPe 2.07
  
• d2bhba2 appears in the current release, SCOPe 2.08