Lineage for d2bhba2 (2bhb A:177-440)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) 
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) Species Escherichia coli [TaxId:562] [55929] (20 PDB entries) 
Domain d2bhba2: 2bhb A:177-440 [128521]
Other proteins in same PDB: d2bhba1
automated match to d1n51a2
complexed with flc, mg, mrd, zn
Details for d2bhba2
PDB Entry: 2bhb (more details), 2.41 Å
PDB Description: zn substituted e. coli aminopeptidase p
PDB Compounds: (A:) xaa-pro aminopeptidaseSCOPe Domain Sequences for d2bhba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhba2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq
SCOPe Domain Coordinates for d2bhba2:
Click to download the PDB-style file with coordinates for d2bhba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bhba2:
- d2bhba2 first appeared in SCOP 1.73
- d2bhba2 appears in SCOPe 2.07
View in 3D
