Lineage for d2bhba1 (2bhb A:1-176)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836701Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 836702Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 836703Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 836707Species Escherichia coli [TaxId:562] [53097] (26 PDB entries)
  8. 836729Domain d2bhba1: 2bhb A:1-176 [128520]
    Other proteins in same PDB: d2bhba2
    automatically matched to d1a16_1
    complexed with flc, mg, mrd, zn

Details for d2bhba1

PDB Entry: 2bhb (more details), 2.41 Å

PDB Description: zn substituted e. coli aminopeptidase p
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOP Domain Sequences for d2bhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhba1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d2bhba1:

Click to download the PDB-style file with coordinates for d2bhba1.
(The format of our PDB-style files is described here.)

Timeline for d2bhba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bhba2