Lineage for d2bhba1 (2bhb A:1-176)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) 
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) Protein Aminopeptidase P [53096] (2 species)
synonym: Xaa-Pro dipeptidase, prolidaseSpecies Escherichia coli [TaxId:562] [53097] (20 PDB entries) 
Domain d2bhba1: 2bhb A:1-176 [128520]
Other proteins in same PDB: d2bhba2
automated match to d1n51a1
complexed with flc, mg, mrd, zn
Details for d2bhba1
PDB Entry: 2bhb (more details), 2.41 Å
PDB Description: zn substituted e. coli aminopeptidase p
PDB Compounds: (A:) xaa-pro aminopeptidaseSCOPe Domain Sequences for d2bhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhba1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
SCOPe Domain Coordinates for d2bhba1:
Click to download the PDB-style file with coordinates for d2bhba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bhba1:
- d2bhba1 first appeared in SCOP 1.73
- d2bhba1 appears in SCOPe 2.07
View in 3D
