Lineage for d2bh7a2 (2bh7 A:7-179)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429380Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1429381Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1429382Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1429439Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, N-terminal domain [143782] (1 species)
  7. 1429440Species Escherichia coli [TaxId:562] [143783] (2 PDB entries)
    Uniprot P75820 22-194
  8. 1429442Domain d2bh7a2: 2bh7 A:7-179 [128517]
    Other proteins in same PDB: d2bh7a1
    automated match to d2wkxa2
    complexed with so4, zn

Details for d2bh7a2

PDB Entry: 2bh7 (more details), 2.2 Å

PDB Description: crystal structure of a semet derivative of amid at 2.2 angstroms
PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase

SCOPe Domain Sequences for d2bh7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh7a2 d.118.1.1 (A:7-179) Probable N-acetylmuramoyl-L-alanine amidase YbjR, N-terminal domain {Escherichia coli [TaxId: 562]}
givekegyqldtrrqaqaayprikvlvihytaddfdsslatltdkqvsshylvpavppry
ngkpriwqlvpeqelawhagisawrgatrlndtsigielenrgwqksagvkyfapfepaq
iqaliplakdiiaryhikpenvvahadiapqrkddpgplfpwqqlaqqgigaw

SCOPe Domain Coordinates for d2bh7a2:

Click to download the PDB-style file with coordinates for d2bh7a2.
(The format of our PDB-style files is described here.)

Timeline for d2bh7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bh7a1