SCOPe 2.03: Domain d2bh7a1: 2bh7 A:180-260

Lineage for d2bh7a1 (2bh7 A:180-260)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (2 families)

5. Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)

6. Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species)

7. Species Escherichia coli [TaxId:562] [140391] (2 PDB entries)
   Uniprot P75820 195-275

8. Domain d2bh7a1: 2bh7 A:180-260 [128516]
   Other proteins in same PDB: d2bh7a2
   automated match to d2wkxa1
   complexed with so4, zn

Details for d2bh7a1

PDB Entry: 2bh7, 2.2 Å

PDB Description: crystal structure of a semet derivative of amid at 2.2 angstroms

PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase

SCOPe Domain Sequences for d2bh7a1:

Sequence; same for both SEQRES and ATOM records:

>d2bh7a1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygq

Timeline for d2bh7a1:

• d2bh7a1 first appeared in SCOP 1.73
  
• d2bh7a1 appears in SCOPe 2.02
  
• d2bh7a1 appears in SCOPe 2.04
  
• d2bh7a1 appears in the current release, SCOPe 2.08