SCOPe 2.06: Domain d2bh2b2: 2bh2 B:75-431

Lineage for d2bh2b2 (2bh2 B:75-431)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.40: (Uracil-5-)-methyltransferase [102581] (1 protein)
   Pfam PF05958

6. Protein rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain [102582] (1 species)
   includes an iron-sulfur cluster-binding, alpha+beta sudbomain

7. Species Escherichia coli [TaxId:562] [102583] (2 PDB entries)

8. Domain d2bh2b2: 2bh2 B:75-431 [128513]
   Other proteins in same PDB: d2bh2a1, d2bh2b1
   automatically matched to d1uwva2
   protein/RNA complex; complexed with sah, sf4

Details for d2bh2b2

PDB Entry: 2bh2, 2.15 Å

PDB Description: crystal structure of e. coli 5-methyluridine methyltransferase ruma in complex with ribosomal rna substrate and s-adenosylhomocysteine.

PDB Compounds: (B:) 23s rRNA (uracil-5-)-methyltransferase ruma

SCOPe Domain Sequences for d2bh2b2:

Sequence; same for both SEQRES and ATOM records:

>d2bh2b2 c.66.1.40 (B:75-431) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]}
eretprcphfgvcggcqqqhasvdlqqrsksaalarlmkhdvseviadvpwgyrrrarls
lnylpktqqlqmgfrkagssdivdvkqcpilapqleallpkvraclgslqamrhlghvel
vqatsgtlmilrhtaplssadreklerfshsegldlylapdseiletvsgempwydsngl
rltfsprdfiqvnagvnqkmvaralewldvqpedrvldlfcgmgnftlplatqaasvvgv
egvpalvekgqqnarlnglqnvtfyhenleedvtkqpwakngfdkvlldparagaagvmq
qiiklepirivyvscnpatlardseallkagytiarlamldmfphtghlesmvlfsr

Timeline for d2bh2b2:

• d2bh2b2 first appeared in SCOP 1.73
  
• d2bh2b2 appears in SCOPe 2.05
  
• d2bh2b2 appears in SCOPe 2.07
  
• d2bh2b2 appears in the current release, SCOPe 2.08