Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.40: (Uracil-5-)-methyltransferase [102581] (1 protein) Pfam PF05958 |
Protein rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain [102582] (1 species) includes an iron-sulfur cluster-binding, alpha+beta sudbomain |
Species Escherichia coli [TaxId:562] [102583] (2 PDB entries) |
Domain d2bh2b2: 2bh2 B:75-431 [128513] Other proteins in same PDB: d2bh2a1, d2bh2b1 automatically matched to d1uwva2 protein/RNA complex; complexed with sah, sf4 |
PDB Entry: 2bh2 (more details), 2.15 Å
SCOPe Domain Sequences for d2bh2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bh2b2 c.66.1.40 (B:75-431) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} eretprcphfgvcggcqqqhasvdlqqrsksaalarlmkhdvseviadvpwgyrrrarls lnylpktqqlqmgfrkagssdivdvkqcpilapqleallpkvraclgslqamrhlghvel vqatsgtlmilrhtaplssadreklerfshsegldlylapdseiletvsgempwydsngl rltfsprdfiqvnagvnqkmvaralewldvqpedrvldlfcgmgnftlplatqaasvvgv egvpalvekgqqnarlnglqnvtfyhenleedvtkqpwakngfdkvlldparagaagvmq qiiklepirivyvscnpatlardseallkagytiarlamldmfphtghlesmvlfsr
Timeline for d2bh2b2: