SCOPe 2.07: Domain d2bh2a1: 2bh2 A:15-74

Lineage for d2bh2a1 (2bh2 A:15-74)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.12: TRAM domain [101768] (3 proteins)
   Pfam PF01938

6. Protein rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain [101769] (1 species)

7. Species Escherichia coli [TaxId:562] [101770] (2 PDB entries)

8. Domain d2bh2a1: 2bh2 A:15-74 [128510]
   Other proteins in same PDB: d2bh2a2, d2bh2b2
   automatically matched to d1uwva1
   protein/RNA complex; complexed with sah, sf4

Details for d2bh2a1

PDB Entry: 2bh2, 2.15 Å

PDB Description: crystal structure of e. coli 5-methyluridine methyltransferase ruma in complex with ribosomal rna substrate and s-adenosylhomocysteine.

PDB Compounds: (A:) 23s rRNA (uracil-5-)-methyltransferase ruma

SCOPe Domain Sequences for d2bh2a1:

Sequence; same for both SEQRES and ATOM records:

>d2bh2a1 b.40.4.12 (A:15-74) rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain {Escherichia coli [TaxId: 562]}
qiitvsvndldsfgqgvarhngktlfipgllpqenaevtvtedkkqyarakvvrrlsdsp

Timeline for d2bh2a1:

• d2bh2a1 first appeared in SCOP 1.73
  
• d2bh2a1 appears in SCOPe 2.06
  
• d2bh2a1 appears in the current release, SCOPe 2.08