Lineage for d2bh2a1 (2bh2 A:15-74)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790356Family b.40.4.12: TRAM domain [101768] (3 proteins)
    Pfam PF01938
  6. 2790363Protein rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain [101769] (1 species)
  7. 2790364Species Escherichia coli [TaxId:562] [101770] (2 PDB entries)
  8. 2790366Domain d2bh2a1: 2bh2 A:15-74 [128510]
    Other proteins in same PDB: d2bh2a2, d2bh2b2
    automatically matched to d1uwva1
    protein/RNA complex; complexed with sah, sf4

Details for d2bh2a1

PDB Entry: 2bh2 (more details), 2.15 Å

PDB Description: crystal structure of e. coli 5-methyluridine methyltransferase ruma in complex with ribosomal rna substrate and s-adenosylhomocysteine.
PDB Compounds: (A:) 23s rRNA (uracil-5-)-methyltransferase ruma

SCOPe Domain Sequences for d2bh2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh2a1 b.40.4.12 (A:15-74) rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain {Escherichia coli [TaxId: 562]}
qiitvsvndldsfgqgvarhngktlfipgllpqenaevtvtedkkqyarakvvrrlsdsp

SCOPe Domain Coordinates for d2bh2a1:

Click to download the PDB-style file with coordinates for d2bh2a1.
(The format of our PDB-style files is described here.)

Timeline for d2bh2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bh2a2