Lineage for d2bgxa1 (2bgx A:180-260)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637353Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 637354Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 637355Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)
  6. 637356Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species)
  7. 637357Species Escherichia coli [TaxId:562] [140391] (2 PDB entries)
  8. 637358Domain d2bgxa1: 2bgx A:180-260 [128504]
    Other proteins in same PDB: d2bgxa2
    complexed with zn

Details for d2bgxa1

PDB Entry: 2bgx (more details), 1.8 Å

PDB Description: crystal structure of native amid at 1.8 angstrom
PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase

SCOP Domain Sequences for d2bgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygq

SCOP Domain Coordinates for d2bgxa1:

Click to download the PDB-style file with coordinates for d2bgxa1.
(The format of our PDB-style files is described here.)

Timeline for d2bgxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bgxa2