Lineage for d2bgrb1 (2bgr B:39-508)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419478Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2419479Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2419486Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2419487Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2419491Domain d2bgrb1: 2bgr B:39-508 [128498]
    Other proteins in same PDB: d2bgra2, d2bgrb2
    automatically matched to d1orva1
    complexed with nag

Details for d2bgrb1

PDB Entry: 2bgr (more details), 2 Å

PDB Description: crystal structure of hiv-1 tat derived nonapeptides tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)
PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bgrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgrb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2bgrb1:

Click to download the PDB-style file with coordinates for d2bgrb1.
(The format of our PDB-style files is described here.)

Timeline for d2bgrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bgrb2