SCOP 1.75: Domain d2bgra1: 2bgr A:39-508

Lineage for d2bgra1 (2bgr A:39-508)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)

8. Domain d2bgra1: 2bgr A:39-508 [128496]
   Other proteins in same PDB: d2bgra2, d2bgrb2
   automatically matched to d1orva1
   complexed with bma, fuc, nag

Details for d2bgra1

PDB Entry: 2bgr, 2 Å

PDB Description: crystal structure of hiv-1 tat derived nonapeptides tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOP Domain Sequences for d2bgra1:

Sequence; same for both SEQRES and ATOM records:

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2bgra1:

• d2bgra1 first appeared in SCOP 1.73
  
• d2bgra1 appears in SCOPe 2.01
  
• d2bgra1 appears in the current release, SCOPe 2.08