Lineage for d2bgnd2 (2bgn D:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901312Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2901319Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2901320Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2901450Domain d2bgnd2: 2bgn D:509-766 [128491]
    Other proteins in same PDB: d2bgna1, d2bgnb1, d2bgnc1, d2bgnd1, d2bgne1, d2bgnf1, d2bgng1, d2bgnh1
    automatically matched to d1orva2
    complexed with nag, zn

Details for d2bgnd2

PDB Entry: 2bgn (more details), 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)
PDB Compounds: (D:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bgnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgnd2 c.69.1.24 (D:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d2bgnd2:

Click to download the PDB-style file with coordinates for d2bgnd2.
(The format of our PDB-style files is described here.)

Timeline for d2bgnd2: