SCOPe 2.08: Domain d2bgnb2: 2bgn B:509-766

Lineage for d2bgnb2 (2bgn B:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2bgnb2: 2bgn B:509-766 [128487]
   Other proteins in same PDB: d2bgna1, d2bgnb1, d2bgnc1, d2bgnd1, d2bgne1, d2bgnf1, d2bgng1, d2bgnh1
   automatically matched to d1orva2
   complexed with nag, zn

Details for d2bgnb2

PDB Entry: 2bgn, 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)

PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bgnb2:

Sequence; same for both SEQRES and ATOM records:

>d2bgnb2 c.69.1.24 (B:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2bgnb2:

• d2bgnb2 first appeared in SCOP 1.73
  
• d2bgnb2 appears in SCOPe 2.07