Lineage for d2bgna1 (2bgn A:39-508)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807891Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 807975Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 807976Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 807983Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 808058Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)
  8. 808135Domain d2bgna1: 2bgn A:39-508 [128484]
    Other proteins in same PDB: d2bgna2, d2bgnb2, d2bgnc2, d2bgnd2, d2bgne1, d2bgnf1, d2bgng1, d2bgnh1
    automatically matched to d1orva1
    complexed with bma, ful, man, nag, zn; mutant

Details for d2bgna1

PDB Entry: 2bgn (more details), 3.15 Å

PDB Description: hiv-1 tat protein derived n-terminal nonapeptide trp2-tat(1-9) bound to the active site of dipeptidyl peptidase iv (cd26)
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOP Domain Sequences for d2bgna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgna1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d2bgna1:

Click to download the PDB-style file with coordinates for d2bgna1.
(The format of our PDB-style files is described here.)

Timeline for d2bgna1: