Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Mayapple (Podophyllum peltatum) [TaxId:35933] [186973] (3 PDB entries) |
Domain d2bgma_: 2bgm A: [128483] automated match to d1nffa_ complexed with max, naj |
PDB Entry: 2bgm (more details), 2 Å
SCOPe Domain Sequences for d2bgma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgma_ c.2.1.0 (A:) automated matches {Mayapple (Podophyllum peltatum) [TaxId: 35933]} tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky vsglnlvidggytrtnpafptalkhgl
Timeline for d2bgma_: