Lineage for d2bgma_ (2bgm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847522Species Mayapple (Podophyllum peltatum) [TaxId:35933] [186973] (3 PDB entries)
  8. 2847524Domain d2bgma_: 2bgm A: [128483]
    automated match to d1nffa_
    complexed with max, naj

Details for d2bgma_

PDB Entry: 2bgm (more details), 2 Å

PDB Description: x-ray structure of ternary-secoisolariciresinol dehydrogenase
PDB Compounds: (A:) rhizome secoisolariciresinol dehydrogenase

SCOPe Domain Sequences for d2bgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgma_ c.2.1.0 (A:) automated matches {Mayapple (Podophyllum peltatum) [TaxId: 35933]}
tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh
cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf
lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi
rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky
vsglnlvidggytrtnpafptalkhgl

SCOPe Domain Coordinates for d2bgma_:

Click to download the PDB-style file with coordinates for d2bgma_.
(The format of our PDB-style files is described here.)

Timeline for d2bgma_: