Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries) |
Domain d2bgfa_: 2bgf A: [128476] automated match to d4auqc_ |
PDB Entry: 2bgf (more details)
SCOPe Domain Sequences for d2bgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgfa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2bgfa_: