Lineage for d2bgci2 (2bgc I:2-137)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426242Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins)
  6. 2426247Protein automated matches [254485] (1 species)
    not a true protein
  7. 2426248Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries)
  8. 2426256Domain d2bgci2: 2bgc I:2-137 [128473]
    Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1
    automated match to d1omia1
    complexed with dtt, dtu; mutant

Details for d2bgci2

PDB Entry: 2bgc (more details), 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
PDB Compounds: (I:) prfa

SCOPe Domain Sequences for d2bgci2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgci2 b.82.3.3 (I:2-137) automated matches {Listeria monocytogenes [TaxId: 169963]}
naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
kqvsyslakfndfsin

SCOPe Domain Coordinates for d2bgci2:

Click to download the PDB-style file with coordinates for d2bgci2.
(The format of our PDB-style files is described here.)

Timeline for d2bgci2: