SCOP 1.75: Domain d2bgch1: 2bgc H:138-235

Lineage for d2bgch1 (2bgc H:138-235)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)

6. Protein Listeriolysin regulatory protein PrfA, C-terminal domain [88975] (1 species)

7. Species Bacteria (Listeria monocytogenes) [TaxId:1639] [88976] (3 PDB entries)

8. Domain d2bgch1: 2bgc H:138-235 [128470]
   Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2
   automatically matched to d1omia2
   complexed with dtt, dtu; mutant

Details for d2bgch1

PDB Entry: 2bgc, 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes

PDB Compounds: (H:) prfa

SCOP Domain Sequences for d2bgch1:

Sequence, based on SEQRES records:

>d2bgch1 a.4.5.4 (H:138-235) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgk

Sequence, based on observed residues (ATOM records):

>d2bgch1 a.4.5.4 (H:138-235) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]}
gklgsicsqlliltyvygketpdgikitldnltmqelsavsriisklkqekvivyknscf
yvqnldylkryapkldewfylacpatwgk

Timeline for d2bgch1:

• d2bgch1 first appeared in SCOP 1.73
  
• d2bgch1 appears in SCOPe 2.01
  
• d2bgch1 appears in the current release, SCOPe 2.08