Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
Protein automated matches [254486] (1 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [255050] (2 PDB entries) |
Domain d2bgcg1: 2bgc G:138-237 [128468] Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2 automated match to d1omia2 complexed with dtt, dtu; mutant |
PDB Entry: 2bgc (more details), 2.3 Å
SCOPe Domain Sequences for d2bgcg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgcg1 a.4.5.4 (G:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]} gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek vivyknscfyvqnldylkryapkldewfylacpatwgkln
Timeline for d2bgcg1: