Lineage for d2bgce1 (2bgc E:138-237)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982714Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1982810Protein automated matches [254486] (1 species)
    not a true protein
  7. 1982811Species Listeria monocytogenes [TaxId:169963] [255050] (2 PDB entries)
  8. 1982815Domain d2bgce1: 2bgc E:138-237 [128464]
    Other proteins in same PDB: d2bgca2, d2bgcb2, d2bgcd2, d2bgce2, d2bgcf2, d2bgcg2, d2bgch2, d2bgci2
    automated match to d1omia2
    complexed with dtt, dtu; mutant

Details for d2bgce1

PDB Entry: 2bgc (more details), 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
PDB Compounds: (E:) prfa

SCOPe Domain Sequences for d2bgce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgce1 a.4.5.4 (E:138-237) automated matches {Listeria monocytogenes [TaxId: 169963]}
gklgsicsqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek
vivyknscfyvqnldylkryapkldewfylacpatwgkln

SCOPe Domain Coordinates for d2bgce1:

Click to download the PDB-style file with coordinates for d2bgce1.
(The format of our PDB-style files is described here.)

Timeline for d2bgce1: