SCOPe 2.07: Domain d2bgca2: 2bgc A:3-137

Lineage for d2bgca2 (2bgc A:3-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins)

6. Protein automated matches [254485] (1 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries)

8. Domain d2bgca2: 2bgc A:3-137 [128459]
   Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1
   automated match to d1omia1
   complexed with dtt, dtu; mutant

Details for d2bgca2

PDB Entry: 2bgc, 2.3 Å

PDB Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes

PDB Compounds: (A:) prfa

SCOPe Domain Sequences for d2bgca2:

Sequence; same for both SEQRES and ATOM records:

>d2bgca2 b.82.3.3 (A:3-137) automated matches {Listeria monocytogenes [TaxId: 169963]}
aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy
ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk
qvsyslakfndfsin

Timeline for d2bgca2:

• d2bgca2 first appeared in SCOP 1.73
  
• d2bgca2 appears in SCOPe 2.06
  
• d2bgca2 appears in the current release, SCOPe 2.08