Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.3: Listeriolysin regulatory protein PrfA, N-terminal domain [89419] (2 proteins) |
Protein automated matches [254485] (1 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [255049] (2 PDB entries) |
Domain d2bgca2: 2bgc A:3-137 [128459] Other proteins in same PDB: d2bgca1, d2bgcb1, d2bgcd1, d2bgce1, d2bgcf1, d2bgcg1, d2bgch1, d2bgci1 automated match to d1omia1 complexed with dtt, dtu; mutant |
PDB Entry: 2bgc (more details), 2.3 Å
SCOPe Domain Sequences for d2bgca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgca2 b.82.3.3 (A:3-137) automated matches {Listeria monocytogenes [TaxId: 169963]} aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk qvsyslakfndfsin
Timeline for d2bgca2: