Lineage for d2bfwa1 (2bfw A:218-413)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910940Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
    Pfam PF00534
  6. 2910944Protein Glycogen synthase 1, GlgA [110735] (2 species)
  7. 2910950Species Pyrococcus abyssi [TaxId:29292] [142768] (2 PDB entries)
    Uniprot Q9V2J8 1-437! Uniprot Q9V2J8 218-413
  8. 2910951Domain d2bfwa1: 2bfw A:218-413 [128456]
    C-terminal domain only
    complexed with act, so4
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2bfwa1

PDB Entry: 2bfw (more details), 1.8 Å

PDB Description: structure of the c domain of glycogen synthase from pyrococcus abyssi
PDB Compounds: (A:) glga glycogen synthase

SCOPe Domain Sequences for d2bfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}
gidcsfwnesyltgsrderkksllskfgmdegvtfmfigrfdrgqkgvdvllkaieilss
kkefqemrfiiigkgdpelegwarsleekhgnvkvitemlsrefvrelygsvdfviipsy
fepfglvaleamclgaipiasavgglrdiitnetgilvkagdpgelanailkalelsrsd
lskfrenckkramsfs

SCOPe Domain Coordinates for d2bfwa1:

Click to download the PDB-style file with coordinates for d2bfwa1.
(The format of our PDB-style files is described here.)

Timeline for d2bfwa1: