Lineage for d2bfus1 (2bfu S:1-189)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431516Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 2431517Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
    chain 1 is one-domain VP23; chain 2 is two-domain VP37
  7. 2431528Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries)
  8. 2431534Domain d2bfus1: 2bfu S:1-189 [128455]
    automatically matched to d1ny711

Details for d2bfus1

PDB Entry: 2bfu (more details), 4 Å

PDB Description: x-ray structure of cpmv top component
PDB Compounds: (S:) cowpea mosaic virus, small (s) subunit

SCOPe Domain Sequences for d2bfus1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfus1 b.121.4.2 (S:1-189) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
gpvcaeasdvyspcmiastppapfsdvtavtfdlingkitpvgddnwnthiynppimnvl
rtaawksgtihvqlnvrgagvkradwdgqvfvylrqsmnpesydartfvisqpgsamlnf
sfdiigpnsgfefaespwanqttwylecvatnprqiqqfevnmrfdpnfrvagnilmppf
plstetppl

SCOPe Domain Coordinates for d2bfus1:

Click to download the PDB-style file with coordinates for d2bfus1.
(The format of our PDB-style files is described here.)

Timeline for d2bfus1: