![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins) duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains |
![]() | Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species) chain 1 is one-domain VP23; chain 2 is two-domain VP37 |
![]() | Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries) |
![]() | Domain d2bful1: 2bfu L:1-182 [128453] automatically matched to d1ny721 |
PDB Entry: 2bfu (more details), 4 Å
SCOPe Domain Sequences for d2bful1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bful1 b.121.4.2 (L:1-182) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]} meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept iy
Timeline for d2bful1: