Lineage for d2bful1 (2bfu L:1-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822235Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 2822236Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
    chain 1 is one-domain VP23; chain 2 is two-domain VP37
  7. 2822247Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries)
  8. 2822251Domain d2bful1: 2bfu L:1-182 [128453]
    automatically matched to d1ny721

Details for d2bful1

PDB Entry: 2bfu (more details), 4 Å

PDB Description: x-ray structure of cpmv top component
PDB Compounds: (L:) cowpea mosaic virus, large (l) subunit

SCOPe Domain Sequences for d2bful1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bful1 b.121.4.2 (L:1-182) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
iy

SCOPe Domain Coordinates for d2bful1:

Click to download the PDB-style file with coordinates for d2bful1.
(The format of our PDB-style files is described here.)

Timeline for d2bful1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bful2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bfus1