SCOPe 2.07: Domain d2bfna_: 2bfn A:

Lineage for d2bfna_ (2bfn A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein Haloalkane dehalogenase [53514] (4 species)

7. Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)

8. Domain d2bfna_: 2bfn A: [128443]
   automated match to d1k5pa_
   complexed with ca, cl, d2p

Details for d2bfna_

PDB Entry: 2bfn, 1.6 Å

PDB Description: the crystal structure of the complex of the haloalkane dehalogenase linb with the product of dehalogenation reaction 1,2-dichloropropane.

PDB Compounds: (A:) halogenalkane dehalogenase

SCOPe Domain Sequences for d2bfna_:

Sequence; same for both SEQRES and ATOM records:

>d2bfna_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
lgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacd
ligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhr
ervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpl
seaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfin
aepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

Timeline for d2bfna_:

• d2bfna_ first appeared in SCOP 1.73, called d2bfna1
  
• d2bfna_ appears in SCOPe 2.06
  
• d2bfna_ appears in the current release, SCOPe 2.08