SCOP 1.75: Domain d2bfna1: 2bfn A:3-296

Lineage for d2bfna1 (2bfn A:3-296)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein)

6. Protein Haloalkane dehalogenase [53514] (3 species)

7. Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)

8. Domain d2bfna1: 2bfn A:3-296 [128443]
   automatically matched to d1mj5a_
   complexed with ca, cl, d2p

Details for d2bfna1

PDB Entry: 2bfn, 1.6 Å

PDB Description: the crystal structure of the complex of the haloalkane dehalogenase linb with the product of dehalogenation reaction 1,2-dichloropropane.

SCOP Domain Sequences for d2bfna1:

Sequence; same for both SEQRES and ATOM records:

>d2bfna1 c.69.1.8 (A:3-296) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
lgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacd
ligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhr
ervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpl
seaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfin
aepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

Timeline for d2bfna1:

• d2bfna1 first appeared in SCOP 1.73
  
• d2bfna1 is called d2bfna_ in SCOPe 2.01
  
• d2bfna1 appears in the current release, SCOPe 2.08, called d2bfna_