![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
![]() | Protein Haloalkane dehalogenase [53514] (4 species) |
![]() | Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries) |
![]() | Domain d2bfna_: 2bfn A: [128443] automated match to d1k5pa_ complexed with ca, cl, d2p |
PDB Entry: 2bfn (more details), 1.6 Å
SCOPe Domain Sequences for d2bfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfna_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} lgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacd ligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhr ervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpl seaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfin aepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa
Timeline for d2bfna_: