Lineage for d2bfgh2 (2bfg H:14-360)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682641Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 682642Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)
  8. 682666Domain d2bfgh2: 2bfg H:14-360 [128438]
    Other proteins in same PDB: d2bfga1, d2bfgb1, d2bfgc1, d2bfgd1, d2bfge1, d2bfgf1, d2bfgg1, d2bfgh1
    automatically matched to 2BFG A:14-360
    complexed with anx, na, so4, xyp, xys; mutant

Details for d2bfgh2

PDB Entry: 2bfg (more details), 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside
PDB Compounds: (H:) beta-xylosidase

SCOP Domain Sequences for d2bfgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfgh2 c.1.8.3 (H:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnapnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

SCOP Domain Coordinates for d2bfgh2:

Click to download the PDB-style file with coordinates for d2bfgh2.
(The format of our PDB-style files is described here.)

Timeline for d2bfgh2: