Lineage for d2bfgf1 (2bfg F:4-13,F:361-502)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 676142Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 676166Protein Beta-D-xylosidase [101926] (2 species)
    glycosyl hydrolase family 39
  7. 676167Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries)
  8. 676189Domain d2bfgf1: 2bfg F:4-13,F:361-502 [128433]
    Other proteins in same PDB: d2bfga2, d2bfgb2, d2bfgc2, d2bfgd2, d2bfge2, d2bfgf2, d2bfgg2, d2bfgh2
    automatically matched to 2BFG A:4-13,A:361-502
    complexed with anx, na, so4, xyp, xys; mutant

Details for d2bfgf1

PDB Entry: 2bfg (more details), 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside
PDB Compounds: (F:) beta-xylosidase

SCOP Domain Sequences for d2bfgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfgf1 b.71.1.2 (F:4-13,F:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]}
vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesav
fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv
lsknevtlieieqvrdetstyvglddgeitsys

SCOP Domain Coordinates for d2bfgf1:

Click to download the PDB-style file with coordinates for d2bfgf1.
(The format of our PDB-style files is described here.)

Timeline for d2bfgf1: