Lineage for d2bfgc2 (2bfg C:14-360)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1339887Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 1339888Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)
    Uniprot Q9ZFM2 15-361
  8. 1339907Domain d2bfgc2: 2bfg C:14-360 [128428]
    Other proteins in same PDB: d2bfga1, d2bfgb1, d2bfgc1, d2bfgd1, d2bfge1, d2bfgf1, d2bfgg1, d2bfgh1
    automated match to d2bfga2
    complexed with anx, na, so4, xys

Details for d2bfgc2

PDB Entry: 2bfg (more details), 2.4 Å

PDB Description: crystal structure of beta-xylosidase (fam gh39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside
PDB Compounds: (C:) beta-xylosidase

SCOPe Domain Sequences for d2bfgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfgc2 c.1.8.3 (C:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnapnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

SCOPe Domain Coordinates for d2bfgc2:

Click to download the PDB-style file with coordinates for d2bfgc2.
(The format of our PDB-style files is described here.)

Timeline for d2bfgc2: